PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SRS
Protein Properties Length: 309aa    MW: 34126.8 Da    PI: 8.2493
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1619genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702223.44.4e-69862442154
       DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..........aeaaskrkrelkskkqsalsst 89 
                  r+g+++CqdCGnqakkdCah RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa+++++++++          + +++kr+r++  + + +l++t
  Gh_A05G1619  86 RQGGMNCQDCGNQAKKDCAHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQQTQQQQQnqqqehqqlfRGDNPKRQRDN--HGSPSLACT 181
                  7899****************************************************9988877766555555554444455555544..666677788 PP

       DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                  +ls ++s   le  ++P+evss+avfrcv+vs++dd e e+aYqtav+i+GhvfkGiLyd+G+e+
  Gh_A05G1619 182 RLSPTTS--GLELGQFPPEVSSPAVFRCVKVSAMDDVEGEFAYQTAVNIAGHVFKGILYDRGPES 244
                  8777765..588899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.0E-6689243IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.7E-2791133IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.0E-25194242IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MAGFFYLGGR EGAASSKQEG EDKEENLYFY RNEEIYNKGF EIWPQYYYQQ QNVNNLSFGA  60
GPSRRTTGFN LSDESSSRSA GFTVMRQGGM NCQDCGNQAK KDCAHLRCRT CCKSRGFQCQ  120
THVKSTWVPA AKRRERQQQL AALQQTQQQQ QNQQQEHQQL FRGDNPKRQR DNHGSPSLAC  180
TRLSPTTSGL ELGQFPPEVS SPAVFRCVKV SAMDDVEGEF AYQTAVNIAG HVFKGILYDR  240
GPESRYTCGG ESSQQLNLIT TASTTAAAAT TTTAATSSNP GTSMIDPSLY PAPLNAFIAG  300
TQFFPPPRS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3942631e-60GQ394263.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS1228 SSR marker CGR6822 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448074.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ51e-100SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0D2S4J40.0A0A0D2S4J4_G
STRINGPOPTR_0002s03000.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-85SHI-related sequence 5